Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Cox4i1), partial

This Recombinant Mouse Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Cox4i1), partial spans the amino acid sequence from region 23-98aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit IV isoform 1; COX IV-1

UniProt

P19783

Expression Region

23-98aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHGSVVKSEDYAFPTYADRRDYPLPDVAHVTMLSASQKALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0080R-BF647-01 20 µL

CD20 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
CD20 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0080R-BF647-02 100 µL

CD20 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
PTN/Pleiotrophin Protein (N-Fc, Mus musculus (Mouse) )
P507554 100 µg

PTN/Pleiotrophin Protein (N-Fc, Mus musculus (Mouse) )

Sign In for Pricing
View Details
TRBJ1-1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2448208 1.0 µg DNA

TRBJ1-1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SNORD96B AAV Vector (Human) (CMV)
44952101 1 µg

SNORD96B AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
GNRHR Antibody
orb389123-01 20 µg

GNRHR Antibody

Sign In for Pricing
View Details