Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cornifin-A (Sprr1a)

This Recombinant Mouse Cornifin-A (Sprr1a) spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small proline-rich protein 1A; SPR1 A; SPR1A

UniProt

Q62266

Expression Region

1-144aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSHQQKQPCTVPPQLHQQQVKQPCQPPPQEPCAPKTKDPCHPVPEPCNPKGPEPCHPKAPEPCHPKAPEPCNPKVPEPCQPKVPEPCQPKVPEPCNPKVPEPCQPKAPEPCHPKAPEPCHPVVPEPCPSTVTPSPYQQKTKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM189A2 Protein Lysate (Mouse) with C-HA Tag
19877034 100 µg

FAM189A2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
KCNJ10 siRNA (Mouse)
MBS8235606-01 15 nmol

KCNJ10 siRNA (Mouse)

Sign In for Pricing
View Details
KCNJ10 siRNA (Mouse)
MBS8235606-02 30 nmol

KCNJ10 siRNA (Mouse)

Sign In for Pricing
View Details
KCNJ10 siRNA (Mouse)
MBS8235606-03 5x 30 nmol

KCNJ10 siRNA (Mouse)

Sign In for Pricing
View Details
Axygen Microcentrifuge tubes 1.7mL
MCT-175-C-S 2500 / PCK

Axygen Microcentrifuge tubes 1.7mL

Sign In for Pricing
View Details
SLC5A7 Human siRNA Oligo Duplex (Locus ID 60482)
SR324811 1 Kit

SLC5A7 Human siRNA Oligo Duplex (Locus ID 60482)

Sign In for Pricing
View Details