Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cornifin-A (Sprr1a)

This Recombinant Mouse Cornifin-A (Sprr1a) spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small proline-rich protein 1A; SPR1 A; SPR1A

UniProt

Q62266

Expression Region

1-144aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSHQQKQPCTVPPQLHQQQVKQPCQPPPQEPCAPKTKDPCHPVPEPCNPKGPEPCHPKAPEPCHPKAPEPCNPKVPEPCQPKVPEPCQPKVPEPCNPKVPEPCQPKAPEPCHPKAPEPCHPVVPEPCPSTVTPSPYQQKTKQK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLEC2L Pre-designed siRNA Set A
SI003199A 1 Each

Human CLEC2L Pre-designed siRNA Set A

Sign In for Pricing
View Details
PCMV-HA-CRK
PPL00487-2a 1 Each

PCMV-HA-CRK

Sign In for Pricing
View Details
CEPT1 Protein Lysate (Mouse) with C-HA Tag
15924034 100 µg

CEPT1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
HIV-1 gp41, Antibody
GWB-1ED0AA 0.1 mg

HIV-1 gp41, Antibody

Sign In for Pricing
View Details
ACTR1A Polyclonal Antibody
MBS9238789-01 0.1 mL

ACTR1A Polyclonal Antibody

Sign In for Pricing
View Details
ACTR1A Polyclonal Antibody
MBS9238789-02 5x 0.1 mL

ACTR1A Polyclonal Antibody

Sign In for Pricing
View Details