Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Meromycolate extension acyl carrier protein (acpM)

This Recombinant Mycobacterium tuberculosis Meromycolate extension acyl carrier protein (acpM) spans the amino acid sequence from region 1-115aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACP

UniProt

P9WQF3

Expression Region

1-115aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr443 (NM_001000285) Rat Tagged Lenti ORF Clone
RR212373L3 10 µg

Olr443 (NM_001000285) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces Pombe rid1 Protein (aa 1-400)
VAng-Yyj6086-500gEcoli 500 µg (E. coli)

Recombinant Schizosaccharomyces Pombe rid1 Protein (aa 1-400)

Sign In for Pricing
View Details
Benadrostin
orb3024213-01 50 mg

Benadrostin

Sign In for Pricing
View Details
Benadrostin
orb3024213-02 10 mg

Benadrostin

Sign In for Pricing
View Details
PTEN Monoclonal Antibody
RA11905-01 50 µL

PTEN Monoclonal Antibody

Sign In for Pricing
View Details
PTEN Monoclonal Antibody
RA11905-02 100 µL

PTEN Monoclonal Antibody

Sign In for Pricing
View Details