Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-12 (SNX12)

This Recombinant Human Sorting nexin-12 (SNX12) spans the amino acid sequence from region 2-172aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9UMY4

Expression Region

2-172aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP4K3 Human Gene Knockout Kit (CRISPR)
KN217448 1 Kit

MAP4K3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dnmt2 (TRDMT1) Rabbit Polyclonal Antibody
AP11029PU-N 400 µL

Dnmt2 (TRDMT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: B-C15]
AM31226PU-N 2 mL (200 Tests)

CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: B-C15]

Sign In for Pricing
View Details
RYBP (N-term) Rabbit Polyclonal Antibody
AP53775PU-N 400 µL

RYBP (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Non-Phospho-Tau (T217) Recombinant Rabbit monoclonal Antibody
HA723845 100 µL

Non-Phospho-Tau (T217) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human ACOXL activation kit by CRISPRa
GA110677 1 Kit

Human ACOXL activation kit by CRISPRa

Sign In for Pricing
View Details