What is the catalog number for Recombinant Human STEAP1 protein (STEAP1) -VLPs?

The catalog number for Recombinant Human STEAP1 protein (STEAP1) -VLPs is orb2658789.

What sizes are available for Recombinant Human STEAP1 protein (STEAP1) -VLPs?

Recombinant Human STEAP1 protein (STEAP1) -VLPs is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human STEAP1 protein (STEAP1) -VLPs come in?

Recombinant Human STEAP1 protein (STEAP1) -VLPs is available in 3 different pack sizes.

Is Recombinant Human STEAP1 protein (STEAP1) -VLPs in stock?

Recombinant Human STEAP1 protein (STEAP1) -VLPs is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Human STEAP1 protein (STEAP1) -VLPs

This Recombinant Human Metalloreductase STEAP1 (STEAP1) -VLPs spans the amino acid sequence from region 1-339aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

Product Name Alternative

Six-transmembrane epithelial antigen of prostate 1

UniProt

Q9UHE8

Expression Region

1-339aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL