Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD9 antigen (Cd9) -VLPs

This Recombinant Mouse CD9 antigen (Cd9) -VLPs spans the amino acid sequence from region 1-226aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

Product Name Alternative

CD antigen CD9

UniProt

P40240

Expression Region

1-226aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OA1 Rabbit pAb, AE conjugated
orb2877173 100 µL

OA1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Human Monocyte Chemotactic Protein 4 (MCP-4) ELISA Kit
NSL0429Hu 96 Tests

Human Monocyte Chemotactic Protein 4 (MCP-4) ELISA Kit

Sign In for Pricing
View Details
EIF5A2 (NM_020390) Human Tagged ORF Clone Lentiviral Particle
RC206249L2V 200 µL

EIF5A2 (NM_020390) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Canine Butyrophilin-like protein 2 (BTNL2) ELISA Kit
MBS7248534-01 48 Well

Canine Butyrophilin-like protein 2 (BTNL2) ELISA Kit

Sign In for Pricing
View Details
Canine Butyrophilin-like protein 2 (BTNL2) ELISA Kit
MBS7248534-02 96 Well

Canine Butyrophilin-like protein 2 (BTNL2) ELISA Kit

Sign In for Pricing
View Details
Canine Butyrophilin-like protein 2 (BTNL2) ELISA Kit
MBS7248534-03 5x 96 Well

Canine Butyrophilin-like protein 2 (BTNL2) ELISA Kit

Sign In for Pricing
View Details