Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sorting nexin-32 (Snx32), partial

This Recombinant Mouse Sorting nexin-32 (Snx32), partial spans the amino acid sequence from region 165-404aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sorting nexin-6B

UniProt

Q80ZJ7

Expression Region

165-404aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQDLSVREKNRKEVLGGLLRSIVRSADEVLITGISGLKEVDDFFEHERTFLVEYHTRIRDTCQRADRVMHSHKCLADNYIPISAALSSLGTQEVNQLKRSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESRQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLLLQNTLVALKGEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSF1 polyclonal antibody
orb645675-01 50 μL

CSF1 polyclonal antibody

Sign In for Pricing
View Details
CSF1 polyclonal antibody
orb645675-02 100 µL

CSF1 polyclonal antibody

Sign In for Pricing
View Details
CSF1 polyclonal antibody
orb645675-03 200 µL

CSF1 polyclonal antibody

Sign In for Pricing
View Details
Recombinant Mouse PR domain zinc finger protein 8 (Prdm8)
MBS1358913-01 0.02 mg (E-Coli)

Recombinant Mouse PR domain zinc finger protein 8 (Prdm8)

Sign In for Pricing
View Details
Recombinant Mouse PR domain zinc finger protein 8 (Prdm8)
MBS1358913-02 0.02 mg (Yeast)

Recombinant Mouse PR domain zinc finger protein 8 (Prdm8)

Sign In for Pricing
View Details
Recombinant Mouse PR domain zinc finger protein 8 (Prdm8)
MBS1358913-03 0.1 mg (E-Coli)

Recombinant Mouse PR domain zinc finger protein 8 (Prdm8)

Sign In for Pricing
View Details