Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sorting nexin-32 (Snx32), partial

This Recombinant Mouse Sorting nexin-32 (Snx32), partial spans the amino acid sequence from region 1-180aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sorting nexin-6B

UniProt

Q80ZJ7

Expression Region

1-180aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80��C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEQHQEAGNESKPSSTSVDLQGDSPLQVEISDAVSERDKVKFTVQTKSGLPHFAQSEFSVVRQHEEFIWLHDTYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGNSSITREEFSKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFSVFLEYSQDLSVREKNRKEVLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat HER2/ErbB2 Protein (aa 67-323, His Tag)
PKSR030455-01 10 µg

Recombinant Rat HER2/ErbB2 Protein (aa 67-323, His Tag)

Sign In for Pricing
View Details
Recombinant Rat HER2/ErbB2 Protein (aa 67-323, His Tag)
PKSR030455-02 50 µg

Recombinant Rat HER2/ErbB2 Protein (aa 67-323, His Tag)

Sign In for Pricing
View Details
Cytochrome b-c1 complex subunit 9/UQCR10 Rabbit Polyclonal Antibody
HA500222 100 µL

Cytochrome b-c1 complex subunit 9/UQCR10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Isopyrazam
TRC-I874600-50MG 50 mg

Isopyrazam

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR560408 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
Human TP53TG3F activation kit by CRISPRa
GA119562 1 Kit

Human TP53TG3F activation kit by CRISPRa

Sign In for Pricing
View Details