Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6 complex locus protein G6f (LY6G6F), partial

This Recombinant Human Lymphocyte antigen 6 complex locus protein G6f (LY6G6F), partial spans the amino acid sequence from region 17-235aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q5SQ64

Expression Region

17-235aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSPCNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGVSFSLAASIDASPALCAPSTGWDMPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Adenovirus Antibody (FL/K87-Ab) ELISA Kit
EIA07443Gu 1 Kit

Guinea pig Adenovirus Antibody (FL/K87-Ab) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal EI24 Antibody [mFluor Violet 450 SE]
NBP2-81820MFV450 0.1 mL

Rabbit Polyclonal EI24 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
UNC5C Rabbit pAb
A3651 200 µL

UNC5C Rabbit pAb

Sign In for Pricing
View Details
SirT1 antibody
70R-34624 100 ug

SirT1 antibody

Sign In for Pricing
View Details
Guinea pig Mannose (MN) ELISA Kit
NSL0530Gp 96 Tests

Guinea pig Mannose (MN) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-27/IL-27 (C-6His)
32-8929-10 10 µg

Recombinant Mouse Interleukin-27/IL-27 (C-6His)

Sign In for Pricing
View Details