Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tubulin beta-5 chain (Tubb5)

This Recombinant Mouse Tubulin beta-5 chain (Tubb5) spans the amino acid sequence from region 1-444aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P99024

Expression Region

1-444aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdx4 (H-4) AC
sc-374471 AC 500 µg/mL - 25% ag

Cdx4 (H-4) AC

Sign In for Pricing
View Details
Sesn1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6391306 1.0 µg DNA

Sesn1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant Human DHPS Protein, N-His
HW482012-01 50 µg

Recombinant Human DHPS Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DHPS Protein, N-His
HW482012-02 100 µg

Recombinant Human DHPS Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DHPS Protein, N-His
HW482012-03 1 mg

Recombinant Human DHPS Protein, N-His

Sign In for Pricing
View Details
Adam12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3941607 1.0 µg DNA

Adam12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details