Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Inter-alpha-trypsin inhibitor

This Recombinant Sheep Inter-alpha-trypsin inhibitor spans the amino acid sequence from region 1-123aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ITI; Inhibitory fragment of ITI

UniProt

P62757

Expression Region

1-123aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEDSCQLGYSQGPCLGMFKRYFYNGTSMACETFYYGGCMGNGNNFPSEKECLQTCRTVQACNLPIVRGPCRAGIELWAFDAVKGKCVRFIYGGCNGNGNQFYSQKECKEYCGIPGEADEELLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TED-347
BA9123-100 100 mg

TED-347

Sign In for Pricing
View Details
2- (3-Methylbutan-2-yl) -2,3-dihydro-1H-isoindol-5-amine
ZTB61287-01 50 mg

2- (3-Methylbutan-2-yl) -2,3-dihydro-1H-isoindol-5-amine

Sign In for Pricing
View Details
2- (3-Methylbutan-2-yl) -2,3-dihydro-1H-isoindol-5-amine
ZTB61287-02 0.5 g

2- (3-Methylbutan-2-yl) -2,3-dihydro-1H-isoindol-5-amine

Sign In for Pricing
View Details
ZNF654 (Zinc Finger Protein 654)
496714 100 µL

ZNF654 (Zinc Finger Protein 654)

Sign In for Pricing
View Details
Rat Monoclonal EPCR Antibody (432714) [mFluor Violet 610 SE]
FAB2749MFV610 0.1 mL

Rat Monoclonal EPCR Antibody (432714) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
AGPAT9 (Glycerol-3-Phosphate Acyltransferase 3, 1-Acylglycerol-3-Phosphate O-Acyltransferase 9)
474908 100 µL

AGPAT9 (Glycerol-3-Phosphate Acyltransferase 3, 1-Acylglycerol-3-Phosphate O-Acyltransferase 9)

Sign In for Pricing
View Details