Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Inter-alpha-trypsin inhibitor

This Recombinant Sheep Inter-alpha-trypsin inhibitor spans the amino acid sequence from region 1-123aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ITI; Inhibitory fragment of ITI

UniProt

P62757

Expression Region

1-123aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEDSCQLGYSQGPCLGMFKRYFYNGTSMACETFYYGGCMGNGNNFPSEKECLQTCRTVQACNLPIVRGPCRAGIELWAFDAVKGKCVRFIYGGCNGNGNQFYSQKECKEYCGIPGEADEELLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Nucleoporin p62 Rabbit Monoclonal Antibody
MA4066-.1 100 µL

Anti-Nucleoporin p62 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TRPM3 (Transient receptor potential cation channel, subfamily M, member 3)
338282-01 50 µL

TRPM3 (Transient receptor potential cation channel, subfamily M, member 3)

Sign In for Pricing
View Details
TRPM3 (Transient receptor potential cation channel, subfamily M, member 3)
338282-02 100 µL

TRPM3 (Transient receptor potential cation channel, subfamily M, member 3)

Sign In for Pricing
View Details
Bbs5 Mouse shRNA Plasmid (Locus ID 72569)
TR504752 1 Kit

Bbs5 Mouse shRNA Plasmid (Locus ID 72569)

Sign In for Pricing
View Details
CHEK1 Antibody, FITC conjugated
A17210-50UG 50 µg

CHEK1 Antibody, FITC conjugated

Sign In for Pricing
View Details
SLC35A3 CRISPR Activation Plasmid (m2)
sc-432900-ACT-2 20 µg

SLC35A3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details