Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 RNA ligase 2 (Y10A)

This Recombinant Enterobacteria phage T4 RNA ligase 2 (Y10A) spans the amino acid sequence from region 1-334aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rnl2

UniProt

P32277

Expression Region

1-334aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology; Molecular Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYCDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFSEKKKSDKPIKAKVELSEADNKLVGILACYVTLNRVNNVISKIGEIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPAWIELVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC153 (Coiled-coil Domain-Containing Protein 153)
477260 100 µL

CCDC153 (Coiled-coil Domain-Containing Protein 153)

Sign In for Pricing
View Details
Human UDP-glucumno-syltransferase 2, UGT2 ELISA Kit
MBS2602955-01 48 Well

Human UDP-glucumno-syltransferase 2, UGT2 ELISA Kit

Sign In for Pricing
View Details
Human UDP-glucumno-syltransferase 2, UGT2 ELISA Kit
MBS2602955-02 96 Well

Human UDP-glucumno-syltransferase 2, UGT2 ELISA Kit

Sign In for Pricing
View Details
Human UDP-glucumno-syltransferase 2, UGT2 ELISA Kit
MBS2602955-03 5x 96 Well

Human UDP-glucumno-syltransferase 2, UGT2 ELISA Kit

Sign In for Pricing
View Details
Human UDP-glucumno-syltransferase 2, UGT2 ELISA Kit
MBS2602955-04 10x 96 Well

Human UDP-glucumno-syltransferase 2, UGT2 ELISA Kit

Sign In for Pricing
View Details
Oct-7-en-2-amine
SDC73381-01 50 mg

Oct-7-en-2-amine

Sign In for Pricing
View Details