Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Patatin-like phospholipase domain-containing protein 4 (PNPLA4)

This Recombinant Human Patatin-like phospholipase domain-containing protein 4 (PNPLA4) spans the amino acid sequence from region 1-253aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calcium-independent phospholipase A2-eta; iPLA2-eta; EC 3.1.1.4; Protein GS2

UniProt

P41247

Expression Region

1-253aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKHINLSFAACGFLGIYHLGAASALCRHGKKLVKDVKAFAGASAGSLVASVLLTAPEKIEECNQFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMESLYQCGFDDTVKFLLKENWFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sm B/B'/N (12F5) HRP
sc-130670 HRP 200 µg/mL

Sm B/B'/N (12F5) HRP

Sign In for Pricing
View Details
Csrp2 Antibody - middle region
ARP34375_P050-25UL 25 µL

Csrp2 Antibody - middle region

Sign In for Pricing
View Details
Gm9781 3'UTR Lenti-reporter-Luc Vector
58260084 1.0 µg

Gm9781 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CYTL1 Human shRNA Lentiviral Particle (Locus ID 54360)
TL317218V 500 µL Each

CYTL1 Human shRNA Lentiviral Particle (Locus ID 54360)

Sign In for Pricing
View Details
8-Oxo-dGTP
B8099-.05 50 µL (100 mM)

8-Oxo-dGTP

Sign In for Pricing
View Details
Glut-1
CR139-1ml 1 mL

Glut-1

Sign In for Pricing
View Details