Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat norvegicus Inhibin beta C chain (Inhbc), partial

This Recombinant Rat norvegicus Inhibin beta C chain (Inhbc), partial spans the amino acid sequence from region 237-351aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin beta-C chain

UniProt

Q9WUK5

Expression Region

237-351aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

INCQGLSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNLLKANTDAGTARRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 Rabbit Polyclonal Antibody
TA372884 100 µL

PAX5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPR62 Human qPCR Primer Pair (NM_080865)
HP216777 200 Reactions

GPR62 Human qPCR Primer Pair (NM_080865)

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Human CD45 Antibody[HI30]
E-AB-F1137R-01 20 Tests

Elab Fluor® Violet 500 Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Human CD45 Antibody[HI30]
E-AB-F1137R-02 100 Tests

Elab Fluor® Violet 500 Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Human CD45 Antibody[HI30]
E-AB-F1137R-03 2x 100 Tests

Elab Fluor® Violet 500 Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Human TOMM6 activation kit by CRISPRa
GA119194 1 Kit

Human TOMM6 activation kit by CRISPRa

Sign In for Pricing
View Details