Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis variant africanum PE family protein PE13

This Recombinant Mycobacterium tuberculosis variant africanum PE family protein PE13 spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A120J0I3

Expression Region

1-101aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis variant africanum

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHVSFVMAYPEMLAAAADTLQSIGATTVASNAAAAAPTTGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCC36 (BRCC3) (NM_001018055) Human Over-expression Lysate
LC422709 20 µg

BRCC36 (BRCC3) (NM_001018055) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS705611 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
STAT1 (Ab-701) Antibody
8B7222-AAT 50 µg

STAT1 (Ab-701) Antibody

Sign In for Pricing
View Details
Recombinant NAE1 Antibody
RC-4365-01 50 μL

Recombinant NAE1 Antibody

Sign In for Pricing
View Details
Recombinant NAE1 Antibody
RC-4365-02 100 µL

Recombinant NAE1 Antibody

Sign In for Pricing
View Details
Recombinant NAE1 Antibody
RC-4365-03 1 mL

Recombinant NAE1 Antibody

Sign In for Pricing
View Details