Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Kidney associated antigen 1

This Recombinant Macaca fascicularis Kidney associated antigen 1 spans the amino acid sequence from region 1-84aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

G7P4J2

Expression Region

1-84aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation; Kidney & Urological Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDDDAAPREEGVPVAVHKHALHDGLRQVAGPGAAATHLPRWPQPQLAAPRREAPPLPQRPHSTQGAGSPPETNEKLTNPQVKRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A13 Antibody
E042757 100 µg -100 µL

SLC25A13 Antibody

Sign In for Pricing
View Details
Olr1304 sgRNA CRISPR Lentivector set (Rat)
K7255801 3x 1.0 µg

Olr1304 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
OCIAD2, NT (OCIA Domain-containing Protein 2, Ovarian Carcinoma Immunoreactive Antigen-like Protein)
MBS6013231-01 0.05 mg

OCIAD2, NT (OCIA Domain-containing Protein 2, Ovarian Carcinoma Immunoreactive Antigen-like Protein)

Sign In for Pricing
View Details
OCIAD2, NT (OCIA Domain-containing Protein 2, Ovarian Carcinoma Immunoreactive Antigen-like Protein)
MBS6013231-02 5x 0.05 mg

OCIAD2, NT (OCIA Domain-containing Protein 2, Ovarian Carcinoma Immunoreactive Antigen-like Protein)

Sign In for Pricing
View Details
ANGPTL4 Antibody
orb192463-01 50 μL

ANGPTL4 Antibody

Sign In for Pricing
View Details
ANGPTL4 Antibody
orb192463-02 100 µL

ANGPTL4 Antibody

Sign In for Pricing
View Details