Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prolactin (Prl)

This Recombinant Mouse Prolactin (Prl) spans the amino acid sequence from region 30-226aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PRL

UniProt

P06879

Expression Region

30-226aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCAF12L2, CT (DCAF12L2, WDR40C, DDB1-and CUL4-associated factor 12-like protein 2, WD repeat-containing protein 40C) (MaxLight 405)
MBS6290963-01 0.1 mL

DCAF12L2, CT (DCAF12L2, WDR40C, DDB1-and CUL4-associated factor 12-like protein 2, WD repeat-containing protein 40C) (MaxLight 405)

Sign In for Pricing
View Details
DCAF12L2, CT (DCAF12L2, WDR40C, DDB1-and CUL4-associated factor 12-like protein 2, WD repeat-containing protein 40C) (MaxLight 405)
MBS6290963-02 5x 0.1 mL

DCAF12L2, CT (DCAF12L2, WDR40C, DDB1-and CUL4-associated factor 12-like protein 2, WD repeat-containing protein 40C) (MaxLight 405)

Sign In for Pricing
View Details
DDX52 Peptide - N-terminal region
orb2019124 100 µg

DDX52 Peptide - N-terminal region

Sign In for Pricing
View Details
Mubritinib
FM32802-01 10 mg

Mubritinib

Sign In for Pricing
View Details
Mubritinib
FM32802-02 50 mg

Mubritinib

Sign In for Pricing
View Details
Recombinant Streptomyces lividans UPF0109 protein
MBS1194107-01 0.02 mg (E-Coli)

Recombinant Streptomyces lividans UPF0109 protein

Sign In for Pricing
View Details