Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-like growth factor I (IGF1)

This Recombinant Bovine Insulin-like growth factor I (IGF1) spans the amino acid sequence from region 50-119aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGF-I; Somatomedin

UniProt

P07455

Expression Region

50-119aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT1A Polyclonal Antibody, HRP Conjugated
A57678-100 100 µL

MT1A Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Dlg4 Mouse Gene Knockout Kit (CRISPR)
KN504612 1 Kit

Dlg4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HTR6 3'UTR Luciferase Stable Cell Line
TU010334 1.0 mL

HTR6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SPRYD3 Antibody - C-terminal region : FITC (ARP60686_P050-FITC)
ARP60686_P050-FITC 100 µL

SPRYD3 Antibody - C-terminal region : FITC (ARP60686_P050-FITC)

Sign In for Pricing
View Details
KIAA1618 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV811977 1.0 µg DNA

KIAA1618 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Destomic Aldehyde
sc-218164 2.5 mg

Destomic Aldehyde

Sign In for Pricing
View Details