Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-like growth factor I (IGF1)

This Recombinant Bovine Insulin-like growth factor I (IGF1) spans the amino acid sequence from region 50-119aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGF-I; Somatomedin

UniProt

P07455

Expression Region

50-119aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-IKB alpha (Tyr42) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-5514R-BF488 100 µL

Phospho-IKB alpha (Tyr42) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
DAI/ZBP1 Rabbit Polyclonal Antibody (Fluoro488)
orb3105059 100 µg

DAI/ZBP1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Anti-TERF2IP Antibody Picoband® Biotin Conjugated
A02374-1-Biotin 100 µg/Vial

Anti-TERF2IP Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details
Psmc6 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K5015003 1.0 µg DNA

Psmc6 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Caspase-4/5 p20 (Cleaved D270/D311) Rabbit Polyclonal Antibody
E28G1910 100 µL

Caspase-4/5 p20 (Cleaved D270/D311) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Xpress™ Human PDCL Over-expressing Stable Cell Line
ABC-X2261 1 Vial

Xpress™ Human PDCL Over-expressing Stable Cell Line

Sign In for Pricing
View Details