Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SAP30-binding protein (SAP30BP), partial

This Recombinant Human SAP30-binding protein (SAP30BP), partial spans the amino acid sequence from region 91-308aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transcriptional regulator protein HCNGP

UniProt

Q9UHR5

Expression Region

91-308aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGPEP1L (NM_001102612) Human Over-expression Lysate
LY420177 100 µg

PGPEP1L (NM_001102612) Human Over-expression Lysate

Sign In for Pricing
View Details
(9R)-9-(2-Pyridinyl)-6-oxaspiro[4.5]decane-9-ethanamine
TRC-P997460-5MG 5 mg

(9R)-9-(2-Pyridinyl)-6-oxaspiro[4.5]decane-9-ethanamine

Sign In for Pricing
View Details
Troxipide
TRC-T011240-250MG 250 mg

Troxipide

Sign In for Pricing
View Details
Fmoc-Arg (Pmc) Wang Resin
H0751501303.25G 25 g

Fmoc-Arg (Pmc) Wang Resin

Sign In for Pricing
View Details
Recombinant Mouse FGF-9/FGF9 Protein (His Tag)
PKSM041022-01 10 µg

Recombinant Mouse FGF-9/FGF9 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse FGF-9/FGF9 Protein (His Tag)
PKSM041022-02 50 µg

Recombinant Mouse FGF-9/FGF9 Protein (His Tag)

Sign In for Pricing
View Details