Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Insulin-like growth factor I (IGF1)

This Recombinant Chicken Insulin-like growth factor I (IGF1) spans the amino acid sequence from region 49-118aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGF-I; Somatomedin

UniProt

P18254

Expression Region

49-118aa

Tag

Tag-Free

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Migfilin Antibody (FBLIM1/4600) [Janelia Fluor 646]
NBP3-14149JF646 0.1 mL

Mouse Monoclonal Migfilin Antibody (FBLIM1/4600) [Janelia Fluor 646]

Sign In for Pricing
View Details
DDX42 Antibody
E310885 200 µL

DDX42 Antibody

Sign In for Pricing
View Details
ND3, NT (MT-ND3, MTND3, NADH3, ND3, NADH-ubiquinone oxidoreductase chain 3, NADH dehydrogenase subunit 3) (MaxLight 750) discontinued
038840-ML750 100 µL

ND3, NT (MT-ND3, MTND3, NADH3, ND3, NADH-ubiquinone oxidoreductase chain 3, NADH dehydrogenase subunit 3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Guinea Pig Olfactory receptor 8D1 (OR8D1) ELISA kit
GTR10424496 96 Well

Guinea Pig Olfactory receptor 8D1 (OR8D1) ELISA kit

Sign In for Pricing
View Details
INE1 Rabbit Polyclonal Antibody (BF647)
orb2498100 100 µL

INE1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Hsp60/HSPD1 Rabbit Polyclonal Antibody (Carrier-free)
orb3077870 100 µg

Hsp60/HSPD1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details