Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interleukin-8 (CXCL8)

This Recombinant Bovine Interleukin-8 (CXCL8) spans the amino acid sequence from region 23-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-8; C-X-C motif chemokine 8; Chemokine C-X-C motif

UniProt

P79255

Expression Region

23-101aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGNEVCLNPKEKWVQKVVQVFVKRAEKQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS807346 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
LSP1 Human qPCR Primer Pair (NM_002339)
HP229478 200 Reactions

LSP1 Human qPCR Primer Pair (NM_002339)

Sign In for Pricing
View Details
OR10V1 Antibody
8G506-AAT 50 µg

OR10V1 Antibody

Sign In for Pricing
View Details
CTNNA3 (NM_001127384) Human Over-expression Lysate
LY426767 100 µg

CTNNA3 (NM_001127384) Human Over-expression Lysate

Sign In for Pricing
View Details
PAK4 Human Gene Knockout Kit (CRISPR)
KN202302BN 1 Kit

PAK4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HypoGel® 200 SH
SP20011015004.0.5G 5 g

HypoGel® 200 SH

Sign In for Pricing
View Details