Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interleukin-8 (CXCL8)

This Recombinant Bovine Interleukin-8 (CXCL8) spans the amino acid sequence from region 23-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-8; C-X-C motif chemokine 8; Chemokine C-X-C motif

UniProt

P79255

Expression Region

23-101aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGNEVCLNPKEKWVQKVVQVFVKRAEKQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem30b Mouse Gene Knockout Kit (CRISPR)
KN517852 1 Kit

Tmem30b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PHF5A activation kit by CRISPRa
GA113716 1 Kit

Human PHF5A activation kit by CRISPRa

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF405S conjugate, 0.1mg/mL
BNC041853-100 1x 100 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Oleoyl-1-stearoyl-sn-glycero-3-phosphocholine
TRC-O532915-10MG 10 mg

2-Oleoyl-1-stearoyl-sn-glycero-3-phosphocholine

Sign In for Pricing
View Details
Human TMEM51 activation kit by CRISPRa
GA110508 1 Kit

Human TMEM51 activation kit by CRISPRa

Sign In for Pricing
View Details
DDI1 Polyclonal Antibody
E-AB-90857-01 60 µL

DDI1 Polyclonal Antibody

Sign In for Pricing
View Details