Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interleukin-8 (CXCL8)

This Recombinant Bovine Interleukin-8 (CXCL8) spans the amino acid sequence from region 23-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-8; C-X-C motif chemokine 8; Chemokine C-X-C motif

UniProt

P79255

Expression Region

23-101aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGNEVCLNPKEKWVQKVVQVFVKRAEKQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD38 Antibody
KC-862-01 50 μL

CD38 Antibody

Sign In for Pricing
View Details
CD38 Antibody
KC-862-02 100 µL

CD38 Antibody

Sign In for Pricing
View Details
CD38 Antibody
KC-862-03 1 mL

CD38 Antibody

Sign In for Pricing
View Details
Rnf170 Mouse Gene Knockout Kit (CRISPR)
KN514924 1 Kit

Rnf170 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Zfp235 activation kit by CRISPRa
GA206020 1 Kit

Mouse Zfp235 activation kit by CRISPRa

Sign In for Pricing
View Details
ASZ1 (NM_001301821) Human Tagged ORF Clone
RG238395 10 µg

ASZ1 (NM_001301821) Human Tagged ORF Clone

Sign In for Pricing
View Details