Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

This Recombinant Bovine Fibroblast growth factor 2 (FGF2) spans the amino acid sequence from region 10-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor (bFGF) ; Heparin-binding growth factor 2 (HBGF-2) ; Kidney-derived growth factor; FGF2

UniProt

P03969

Expression Region

10-155aa

Tag

Tag-Free

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of NIH-3T3 cells is 0.9252-2.630 ng/mL.

Form

Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC1 Mouse Monoclonal Antibody [Clone ID: LBI1C3]
AMM10255VCF 100 µg

ERCC1 Mouse Monoclonal Antibody [Clone ID: LBI1C3]

Sign In for Pricing
View Details
Mouse Monoclonal IGF-I Antibody (SPM406) [Alexa Fluor 405]
NBP2-34409AF405 0.1 mL

Mouse Monoclonal IGF-I Antibody (SPM406) [Alexa Fluor 405]

Sign In for Pricing
View Details
FAM83G Peptide - C-terminal region
orb2005340 100 µg

FAM83G Peptide - C-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal DC8 Antibody [Janelia Fluor 646]
NBP2-99483JF646 0.1 mL

Rabbit Polyclonal DC8 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Anti-SUPT3H Rabbit pAb
GB112125 100 μL

Anti-SUPT3H Rabbit pAb

Sign In for Pricing
View Details
TTLL6 sgRNA CRISPR Lentivector (Human) (Target 1)
K2552402 1.0 µg DNA

TTLL6 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details