Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-hemoglobin-stabilizing protein (Ahsp)

This Recombinant Mouse Alpha-hemoglobin-stabilizing protein (Ahsp) spans the amino acid sequence from region 1-102aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Erythroid differentiation-related factor; Erythroid-associated factor

UniProt

Q9CY02

Expression Region

1-102aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPFQSNKDLISTGIKEFNVLLDQQVFDDPLISEEDMVIVVHDWVNLYTNYYKKLVHGEQEEQDRAMTEFQQELSTLGSQFLAKYRTFLKSKEPPSNTLPSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPY19L1P2 AAV siRNA Pooled Vector
18569161 1.0 µg

DPY19L1P2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ATP citrate lyase (ACLY) Rabbit Polyclonal Antibody
TA329520 100 µL

ATP citrate lyase (ACLY) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATG4B, NT (ATG4B, APG4B, AUTL1, KIAA0943, Cysteine protease ATG4B, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B) (Biotin)
MBS6276141-01 0.2 mL

ATG4B, NT (ATG4B, APG4B, AUTL1, KIAA0943, Cysteine protease ATG4B, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B) (Biotin)

Sign In for Pricing
View Details
ATG4B, NT (ATG4B, APG4B, AUTL1, KIAA0943, Cysteine protease ATG4B, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B) (Biotin)
MBS6276141-02 5x 0.2 mL

ATG4B, NT (ATG4B, APG4B, AUTL1, KIAA0943, Cysteine protease ATG4B, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B) (Biotin)

Sign In for Pricing
View Details
Recombinant Human PTGER3 Protein - (Dry Ice)
H00005733-P01-25ug 25 µg

Recombinant Human PTGER3 Protein - (Dry Ice)

Sign In for Pricing
View Details
Human AP3M2 (NM_006803) AAV Particle
RC208101A1V 250 µL

Human AP3M2 (NM_006803) AAV Particle

Sign In for Pricing
View Details