Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-epidermal growth factor (EGF), partial

This Recombinant Human Pro-epidermal growth factor (EGF), partial spans the amino acid sequence from region 971-1023aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EGF; Urogastrone

UniProt

P01133

Expression Region

971-1023aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDG Antibody - middle region
ARP88521_P050-25UL 25 µL

TDG Antibody - middle region

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (B22.1), CF647 conjugate, 0.1mg/mL
BNC471266-100 1x 100 µL

Cytokeratin 8 (KRT8) (B22.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse CPSF6 shRNA Plasmid
abx984017-01 150 µg

Mouse CPSF6 shRNA Plasmid

Sign In for Pricing
View Details
Mouse CPSF6 shRNA Plasmid
abx984017-02 300 µg

Mouse CPSF6 shRNA Plasmid

Sign In for Pricing
View Details
FG-DN40PN100-MTL Flange Guards
311830 1 Pack (1 Piece (s) x 1 Pack)

FG-DN40PN100-MTL Flange Guards

Sign In for Pricing
View Details
Pdp1 (NM_001033453) Mouse Tagged ORF Clone Lentiviral Particle
MR219300L4V 200 µL

Pdp1 (NM_001033453) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details