Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-epidermal growth factor (EGF), partial

This Recombinant Human Pro-epidermal growth factor (EGF), partial spans the amino acid sequence from region 971-1023aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EGF; Urogastrone

UniProt

P01133

Expression Region

971-1023aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sqstm1 (Sequestosome-1) ELISA Kit
EM8225 96 Tests

Mouse Sqstm1 (Sequestosome-1) ELISA Kit

Sign In for Pricing
View Details
TRPC3 Antibody
orb523500-01 50 μL

TRPC3 Antibody

Sign In for Pricing
View Details
TRPC3 Antibody
orb523500-02 100 µL

TRPC3 Antibody

Sign In for Pricing
View Details
M/M014/NL280/TM-297X420-1 Personal Protection (PPE) Signs & Labels (Adhesive)
199060 1 Pack (1 Panel (s) x 1 Pack)

M/M014/NL280/TM-297X420-1 Personal Protection (PPE) Signs & Labels (Adhesive)

Sign In for Pricing
View Details
2-[ (4-Acetamidophenyl) sulfanyl]propanoic acid
ENB57540-01 250 mg

2-[ (4-Acetamidophenyl) sulfanyl]propanoic acid

Sign In for Pricing
View Details
2-[ (4-Acetamidophenyl) sulfanyl]propanoic acid
ENB57540-02 2.5 g

2-[ (4-Acetamidophenyl) sulfanyl]propanoic acid

Sign In for Pricing
View Details