Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial

This Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial spans the amino acid sequence from region 234-362aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent phosphate transport protein 2B; Sodium-phosphate transport protein 2B; Na (+) -dependent phosphate cotransporter 2B; NaPi3b; Sodium/phosphate cotransporter 2B; Na (+) /Pi cotransporter 2B; NaPi-2b; Solute carrier family 34 member 2

UniProt

O95436

Expression Region

234-362aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant S100B Antibody / S100 calcium-binding protein B
V5791-20UG 20 µg

Recombinant S100B Antibody / S100 calcium-binding protein B

Sign In for Pricing
View Details
CDON Polyclonal Antibody
E915830 100 µL

CDON Polyclonal Antibody

Sign In for Pricing
View Details
SIGLECL1 Antibody
46-369 0.1 mg

SIGLECL1 Antibody

Sign In for Pricing
View Details
Human anti-Staphylococcus aureus PsaA IgM
E4A11A47-PA-M-100 100 µg

Human anti-Staphylococcus aureus PsaA IgM

Sign In for Pricing
View Details
Phospho-p53-S15 polyclonal antibody
orb1717399-01 50 µL

Phospho-p53-S15 polyclonal antibody

Sign In for Pricing
View Details
Phospho-p53-S15 polyclonal antibody
orb1717399-02 100 µL

Phospho-p53-S15 polyclonal antibody

Sign In for Pricing
View Details