Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active)

This Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active) spans the amino acid sequence from region 33-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD79a

UniProt

P11912

Expression Region

33-143aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/mL can bind Anti-CD79A recombinant antibody. The EC50 is 1.521-1.700 ng/mL.

Form

Lyophilized powder

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NCR1 Protein (Fc Tag)
PKSH032783-01 10 µg

Recombinant Human NCR1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human NCR1 Protein (Fc Tag)
PKSH032783-02 50 µg

Recombinant Human NCR1 Protein (Fc Tag)

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), Biotin conjugate, 0.1mg/mL
BNCB2037-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (DF1513), 0.2mg/mL
BNUB0188-500 1x 500 µL

CD71 (DF1513), 0.2mg/mL

Sign In for Pricing
View Details
FITC Anti-Human CD21 Antibody[HI21a]
E-AB-F1320C-01 20 Tests

FITC Anti-Human CD21 Antibody[HI21a]

Sign In for Pricing
View Details
FITC Anti-Human CD21 Antibody[HI21a]
E-AB-F1320C-02 100 Tests

FITC Anti-Human CD21 Antibody[HI21a]

Sign In for Pricing
View Details