Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active)
This Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active) spans the amino acid sequence from region 33-143aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD79a
UniProt
P11912
Expression Region
33-143aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 90% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/mL can bind Anti-CD79A recombinant antibody. The EC50 is 1.521-1.700 ng/mL.
Form
Lyophilized powder
Molecular Weight
14.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS626733-01 0.2 mL
NAT2, CT (N-acetyltransferase Type 2, NAT-2, Arylamine N-acetyltransferase 2, Arylamide Acetylase 2, AAC2, Polymorphic Arylamine N-acetyltransferase, PNAT)
Sign In for Pricing
View Details MBS626733-02 5x 0.2 mL
NAT2, CT (N-acetyltransferase Type 2, NAT-2, Arylamine N-acetyltransferase 2, Arylamide Acetylase 2, AAC2, Polymorphic Arylamine N-acetyltransferase, PNAT)
Sign In for Pricing
View Details 
