Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Atrial natriuretic peptide receptor 1 (Npr1), partial

This Recombinant Mouse Atrial natriuretic peptide receptor 1 (Npr1), partial spans the amino acid sequence from region 29-469aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Atrial natriuretic peptide receptor 1; EC:4.6.1.2; Atrial natriuretic peptide receptor type A (ANP-A; ANPR-A; NPR-A) ; Guanylate cyclase A (GC-A)

UniProt

P18293

Expression Region

29-469aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

50.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

SDLTVAVVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYTKLLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDDGQDRRARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYWPLGYPPPDIPKCGFDNEDPACNQDHFSTLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cyclooxygenase 2 Monoclonal Antibody
E-AB-81464-01 50 µL

Recombinant Cyclooxygenase 2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Cyclooxygenase 2 Monoclonal Antibody
E-AB-81464-02 100 µL

Recombinant Cyclooxygenase 2 Monoclonal Antibody

Sign In for Pricing
View Details
MYPT1 (Ab-696) Antibody
8B0517-AAT 50 µg

MYPT1 (Ab-696) Antibody

Sign In for Pricing
View Details
SV2A Antibody
KC-538-01 50 μL

SV2A Antibody

Sign In for Pricing
View Details
SV2A Antibody
KC-538-02 100 µL

SV2A Antibody

Sign In for Pricing
View Details
SV2A Antibody
KC-538-03 1 mL

SV2A Antibody

Sign In for Pricing
View Details