Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)

This Recombinant Human Activin receptor type-2A (ACVR2A), partial (Active) spans the amino acid sequence from region 20-135aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA) ; ACVR2A; ACVR2

UniProt

P27037, A0A7N9IF81

Expression Region

20-135aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2A at 2 μg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 3.848-4.375 ng/mL.

Form

Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPZ CRISPRa sgRNA lentivector (set of three targets)(Mouse)
16793124 3x 1.0µg DNA

CPZ CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Rat Map2k7 Pre-designed siRNA Set A
SI208066A 1 Each

Rat Map2k7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Camkv 3'UTR Luciferase Stable Cell Line
TU103081 1.0 mL

Camkv 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Rat KIF2B Protein, His (Fc)-Avi-tagged
KIF2B-2912R 50 µg

Recombinant Rat KIF2B Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Acetylcysteine
M15331-01 1 g

Acetylcysteine

Sign In for Pricing
View Details
Acetylcysteine
M15331-02 100 mg

Acetylcysteine

Sign In for Pricing
View Details