Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Activin receptor type-2A (Acvr2a), partial (Active)

This Recombinant Mouse Activin receptor type-2A (Acvr2a), partial (Active) spans the amino acid sequence from region 20-135aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA) ; Acvr2a; Acvr2

UniProt

P27038

Expression Region

20-135aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2a at 2 μg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 1.562-1.966 ng/mL.

Form

Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

AILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lupeol dihydrocinnamate
T32970-01 100 mg

Lupeol dihydrocinnamate

Sign In for Pricing
View Details
Lupeol dihydrocinnamate
T32970-02 500 mg

Lupeol dihydrocinnamate

Sign In for Pricing
View Details
AS3MT Antibody (FITC)
orb417533-01 50 µg

AS3MT Antibody (FITC)

Sign In for Pricing
View Details
AS3MT Antibody (FITC)
orb417533-02 100 µg

AS3MT Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Protein CrcB homolog (crcB)
orb2921528-01 20 µg

Recombinant Synechococcus sp. Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Protein CrcB homolog (crcB)
orb2921528-02 100 µg

Recombinant Synechococcus sp. Protein CrcB homolog (crcB)

Sign In for Pricing
View Details