Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active)

This Recombinant Mouse Activin receptor type-2B (Acvr2b), partial spans the amino acid sequence from region 19-137aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-2B; EC: 2.7.11.30; Activin receptor type IIB (ACTR-IIB) ; Acvr2b

UniProt

P27040

Expression Region

19-137aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2b at 2 μg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 3.560-4.235 ng/mL.

Form

Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTLLT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (Biotin)
168753-AF-Biotin 100 µL

Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (Biotin)

Sign In for Pricing
View Details
3-[1- (3-Bromophenyl) -1-hydroxy-n-butyl]benzoic Acid t-Butyl Ester
423495-01 10 mg

3-[1- (3-Bromophenyl) -1-hydroxy-n-butyl]benzoic Acid t-Butyl Ester

Sign In for Pricing
View Details
3-[1- (3-Bromophenyl) -1-hydroxy-n-butyl]benzoic Acid t-Butyl Ester
423495-02 25 mg

3-[1- (3-Bromophenyl) -1-hydroxy-n-butyl]benzoic Acid t-Butyl Ester

Sign In for Pricing
View Details
Human APOBEC3F Protein Lysate
MBS137378-01 0.02 mg

Human APOBEC3F Protein Lysate

Sign In for Pricing
View Details
Human APOBEC3F Protein Lysate
MBS137378-02 5x 0.02 mg

Human APOBEC3F Protein Lysate

Sign In for Pricing
View Details
(+) -Taxifolin
sc-202829 10 mg

(+) -Taxifolin

Sign In for Pricing
View Details