Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 NAD--protein ADP-ribosyltransferase modA (modA)

This Recombinant Enterobacteria phage T4 NAD--protein ADP-ribosyltransferase modA (modA) spans the amino acid sequence from region 1-200aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNA polymerase ADP-ribosylase modA

UniProt

P39421

Expression Region

1-200aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKYSVMQLKDFKIKSMDASVRASIREELLSEGFNLSEIELLIHCITNKPDDHSWLNEIIKSRLVPNDKPLWRGVPAETKQVLNQGIDIITFDKVVSASYDKNIALHFASGLEYNTQVIFEFKAPMVFNFQEYAIKALRCKEYNPNFKFPDSHRYRNMELVSDEQEVMIPAGSVFRIADRYEYKKCSTYTIYTLDFEGFNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIRIP3 Rabbit Polyclonal Antibody
TA370393 100 µL

HIRIP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HBEGF Antibody (HRP)
KH-2685-01 50 μL

HBEGF Antibody (HRP)

Sign In for Pricing
View Details
HBEGF Antibody (HRP)
KH-2685-02 100 µL

HBEGF Antibody (HRP)

Sign In for Pricing
View Details
HBEGF Antibody (HRP)
KH-2685-03 1 mL

HBEGF Antibody (HRP)

Sign In for Pricing
View Details
Rhodopsin (RHO) Rabbit Polyclonal Antibody
AP06577PU-N 100 µg

Rhodopsin (RHO) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MHC Class II I-Ap Mouse Monoclonal Antibody [Clone ID: 7-16.17]
CL072F 100 µg

MHC Class II I-Ap Mouse Monoclonal Antibody [Clone ID: 7-16.17]

Sign In for Pricing
View Details