Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-synuclein (SNCA)

This Recombinant Human Alpha-synuclein (SNCA) spans the amino acid sequence from region 1-140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP

UniProt

P37840

Expression Region

1-140aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Free Prostate Specific Antigen FPSA ELISA Kit
BG-HUM10960 1 Each

Human Free Prostate Specific Antigen FPSA ELISA Kit

Sign In for Pricing
View Details
Rabbit EG-VEGF (Endocrine Gland Derived Vascular Endothelial Growth Factor) ValidElisa Kit
EK346515 96 Well

Rabbit EG-VEGF (Endocrine Gland Derived Vascular Endothelial Growth Factor) ValidElisa Kit

Sign In for Pricing
View Details
PIP5K1P2 Protein Vector (Human) (pPM-C-His)
PV111101 500 ng

PIP5K1P2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-IL12B/IL-12 p40/NKSF2 Antibody (R1T73)
RHD84004 100 μg

Anti-IL12B/IL-12 p40/NKSF2 Antibody (R1T73)

Sign In for Pricing
View Details
Chicken Bombesin receptor subtype-3 (BRS3) ELISA Kit
MBS7212181-01 48 Well

Chicken Bombesin receptor subtype-3 (BRS3) ELISA Kit

Sign In for Pricing
View Details
Chicken Bombesin receptor subtype-3 (BRS3) ELISA Kit
MBS7212181-02 96 Well

Chicken Bombesin receptor subtype-3 (BRS3) ELISA Kit

Sign In for Pricing
View Details