Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Focadhesin (FOCAD), partial

This Recombinant Human Focadhesin (FOCAD), partial spans the amino acid sequence from region 1-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KIAA1797

UniProt

Q5VW36

Expression Region

1-150aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDDIRKRFEFPNSLIQSQAVGHLIAAVLKENGFSEKIHQSTNQTPALNLLWEKCCSDNVVVRTACCEGLVALVAQDHAEFSYVLNGILNLIPSTRNTHGLIKAIMHLLQMQALKEGQGGEKNIQSIYTIRNHPHPLITVLEHRPDCWPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB2 Protein Vector (Rat) (pPM-C-HA)
43473026 500 ng

SERPINB2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human KLRF1 shRNA (UAS) - Lentiviral human KLRF1 shRNA (UAS, RFP) (100)
GTR15097920 1 Vial

Lentiviral human KLRF1 shRNA (UAS) - Lentiviral human KLRF1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Pacific Blue™ anti-mouse/human Helios
GT04136 100 Tests

Pacific Blue™ anti-mouse/human Helios

Sign In for Pricing
View Details
O-Desmethyl Lacosamide
orb3027331-01 1 mg

O-Desmethyl Lacosamide

Sign In for Pricing
View Details
O-Desmethyl Lacosamide
orb3027331-02 5 mg

O-Desmethyl Lacosamide

Sign In for Pricing
View Details
O-Desmethyl Lacosamide
orb3027331-03 10 mg

O-Desmethyl Lacosamide

Sign In for Pricing
View Details