Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eucalyptus gunnii Caffeic acid 3-O-methyltransferase (OMT)

This Recombinant Eucalyptus gunnii Caffeic acid 3-O-methyltransferase (OMT) spans the amino acid sequence from region 1-366aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAOMT; COMT; S-adenosysl-L-methionine:caffeic acid 3-O-methyltransferase

UniProt

P46484

Expression Region

1-366aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Eucalyptus gunnii (Cider gum)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPGEVAAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRNLPDGKVERLYGLAPVCKFLVKNEDGVSIAALNLMNQDKILMESWYYLKDAVLEGGIPFNKAYGMTAFEYHGTDPRFNKIFNRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSMKGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNIGKVIVAECVLPVYPDTSLATKNVIHIDCIMLAHNPGGKERTQKEFETLAKGAGFQGFQVMCCAFGTHVMEFLKTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SerpinA3m Double Nickase Plasmid (m2)
sc-423117-NIC-2 20 µg

SerpinA3m Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
SPBC800.11 Antibody
orb858139 2 mg

SPBC800.11 Antibody

Sign In for Pricing
View Details
ELISA Kit For V-set and immunoglobulin domain-containing protein 1
E3954c 96 Tests

ELISA Kit For V-set and immunoglobulin domain-containing protein 1

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Phosphoethanolamine transferase eptB (eptB)
MBS1232167 Inquire

Recombinant Salmonella typhimurium Phosphoethanolamine transferase eptB (eptB)

Sign In for Pricing
View Details
Ly49s5 Rat siRNA Oligo Duplex (Locus ID 503662)
SR514925 1 Kit

Ly49s5 Rat siRNA Oligo Duplex (Locus ID 503662)

Sign In for Pricing
View Details
SERINC1, CT (SERINC1, KIAA1253, TDE1L, TDE2, Serine incorporator 1, Tumor differentially expressed protein 1-like, Tumor differentially expressed protein 2) (MaxLight 550) discontinued
041568-ML550 100 µL

SERINC1, CT (SERINC1, KIAA1253, TDE1L, TDE2, Serine incorporator 1, Tumor differentially expressed protein 1-like, Tumor differentially expressed protein 2) (MaxLight 550) discontinued

Sign In for Pricing
View Details