Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM171A2 (FAM171A2), partial

This Recombinant Human Protein FAM171A2 (FAM171A2), partial spans the amino acid sequence from region 30-125aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A8MVW0

Expression Region

30-125aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSPPEPPSPQEILIKVQVYVSGELVPLARASVDVFGNRTLLAAGTTDSEGVATLPLSYRLGTWVLVTAARPGFLTNSVPWRVDKLPLYASVSLYLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Creatine Kinase BB  (3D5-3D11)
YF-MA12455 100 ug

Anti-Creatine Kinase BB (3D5-3D11)

Sign In for Pricing
View Details
ZSCAN10 Protein Vector (Rat) (pPM-C-HA)
PV318432 500 ng

ZSCAN10 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
KMT2D Polyclonal Antibody
ANT-12926-50ug 50 µg

KMT2D Polyclonal Antibody

Sign In for Pricing
View Details
ARMCX2/ALEX2 Rabbit pAb
E2821947 100 µL

ARMCX2/ALEX2 Rabbit pAb

Sign In for Pricing
View Details
Butyl 4- (4- (tert-butoxycarbonyl) piperazin-1-yl) -6-bromoquinoline-2-carboxylate
sc-337606 100 mg

Butyl 4- (4- (tert-butoxycarbonyl) piperazin-1-yl) -6-bromoquinoline-2-carboxylate

Sign In for Pricing
View Details
Human von Willebrand Factor, vWF ELISA Kit
YLA1741HU-01 48 Tests

Human von Willebrand Factor, vWF ELISA Kit

Sign In for Pricing
View Details