Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial

This Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial spans the amino acid sequence from region 176-246aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-NRG1; Acetylcholine receptor-inducing activity; ARIA; Breast cancer cell differentiation factor p45; Glial growth factor; Heregulin; HRG; Neu differentiation factor; Sensory and motor neuron-derived factor

UniProt

Q02297

Expression Region

176-246aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reticulon 4 Receptor (RTN4R) Antibody
abx321708-01 20 µL

Reticulon 4 Receptor (RTN4R) Antibody

Sign In for Pricing
View Details
Reticulon 4 Receptor (RTN4R) Antibody
abx321708-02 50 µL

Reticulon 4 Receptor (RTN4R) Antibody

Sign In for Pricing
View Details
Reticulon 4 Receptor (RTN4R) Antibody
abx321708-03 100 µL

Reticulon 4 Receptor (RTN4R) Antibody

Sign In for Pricing
View Details
Reticulon 4 Receptor (RTN4R) Antibody
abx321708-04 200 µL

Reticulon 4 Receptor (RTN4R) Antibody

Sign In for Pricing
View Details
Reticulon 4 Receptor (RTN4R) Antibody
abx321708-05 1 mL

Reticulon 4 Receptor (RTN4R) Antibody

Sign In for Pricing
View Details
C8B Rabbit pAb
E2508324 100 µL

C8B Rabbit pAb

Sign In for Pricing
View Details