Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phleum pratense Profilin-1 (PRO1)

This Recombinant Phleum pratense Profilin-1 (PRO1) spans the amino acid sequence from region 2-131aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Phl p 11; Pollen allergen Phl p 12; allergen Phl p 12

UniProt

P35079

Expression Region

2-131aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Phleum pratense (Common timothy)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MID1 (NM_000381) Human Over-expression Lysate
LC424750 20 µg

MID1 (NM_000381) Human Over-expression Lysate

Sign In for Pricing
View Details
SATB2 Rabbit Monoclonal Antibody
TA422251 100 µL

SATB2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Jagged1 (JAG1) (C-term) Rabbit Polyclonal Antibody
AP52261PU-N 400 µL

Jagged1 (JAG1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS809032 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Recombinant GTF2I Antibody
RC-5942-01 50 μL

Recombinant GTF2I Antibody

Sign In for Pricing
View Details
Recombinant GTF2I Antibody
RC-5942-02 100 µL

Recombinant GTF2I Antibody

Sign In for Pricing
View Details