Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phleum pratense Profilin-1 (PRO1)

This Recombinant Phleum pratense Profilin-1 (PRO1) spans the amino acid sequence from region 2-131aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Phl p 11; Pollen allergen Phl p 12; allergen Phl p 12

UniProt

P35079

Expression Region

2-131aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Phleum pratense (Common timothy)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L6H21
565158 5.0mg

L6H21

Sign In for Pricing
View Details
ELISA Kit For Tachykinin-4
E10067h 96 Tests

ELISA Kit For Tachykinin-4

Sign In for Pricing
View Details
CNN1 (Calponin-1, Calponin H1, Smooth Muscle, Basic Calponin, Calponin 1) (HRP)
125128-HRP 100 µL

CNN1 (Calponin-1, Calponin H1, Smooth Muscle, Basic Calponin, Calponin 1) (HRP)

Sign In for Pricing
View Details
Human C9orf57 siRNA
abx909985-01 15 nmol

Human C9orf57 siRNA

Sign In for Pricing
View Details
Human C9orf57 siRNA
abx909985-02 30 nmol

Human C9orf57 siRNA

Sign In for Pricing
View Details
Human PRAP1 / Proline-rich acidic protein 1 Recombinant Protein
R1626h 1 Each

Human PRAP1 / Proline-rich acidic protein 1 Recombinant Protein

Sign In for Pricing
View Details