Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilaginoidea virens Phosphoacetylglucosamine mutase

This Recombinant Ustilaginoidea virens Phosphoacetylglucosamine mutase spans the amino acid sequence from region 1-538aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A063BTC5

Expression Region

1-538aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Ustilaginoidea virens (Rice false smut fungus) (Villosiclava virens)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDEKILAASAKYPIVAGQRYRYGTAGFRMKADLLAGVSFRVGLLAGLRSRKLNGQAIGVMITASHNPAADNGIKIVDPMGEMLEQEWESYATRLVNCRTDQELLDTYKAMATQLKVDMHTSGRVIYGRDTRPSGHSLVCALAAALDATDTNHTDYKILTTPQLHYLTRCVNTEGTPKAYGEASEVGYYEKFADAFVRALRGKKIRGQLIVDCANGVGGPKLSEMLKFIPKHVSGFDVRLVNDDVLRPEVLNLDCGADFVKTKQRAPLSPKPVPGVRCCSFDGDADRLIYYWVDPEMGFVMLDGDRISSLCASFIGDLVRSAGLADELRIGVVQTAYANGASTTYIERHLQLPVVFTNTGVKHLHHAACQFDVGVYFEANGHGTVVFSQEAMRAFVEKEPQSPAQKAALETLAAVGDLVNQTVGDAISDMLMVEVVLAHKDWTLKDWAMTYTDRPNRLVRVEVGNKHLFQATDAERRLSHPPGAQDEIDQVVQKYTTARSFARASGTENACRVYAEAATRSEADELANKVAQIVKQFGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-100 1x 100 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL
BNC880630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
BNC940226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details