Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C1orf54 (C1orf54)

This Recombinant Human Uncharacterized protein C1orf54 (C1orf54) spans the amino acid sequence from region 17-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8WWF1

Expression Region

17-131aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC067355 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV813682 1.0 µg DNA

BC067355 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Human anti-Lol p 11 IgE
A11Y52-E 1 Each

Human anti-Lol p 11 IgE

Sign In for Pricing
View Details
Bovine ATP-sensitive inward rectifier potassium channel 12, KCNJ12/Kir2.2 ELISA Kit
MBS1602191-01 48 Well

Bovine ATP-sensitive inward rectifier potassium channel 12, KCNJ12/Kir2.2 ELISA Kit

Sign In for Pricing
View Details
Bovine ATP-sensitive inward rectifier potassium channel 12, KCNJ12/Kir2.2 ELISA Kit
MBS1602191-02 96 Well

Bovine ATP-sensitive inward rectifier potassium channel 12, KCNJ12/Kir2.2 ELISA Kit

Sign In for Pricing
View Details
Bovine ATP-sensitive inward rectifier potassium channel 12, KCNJ12/Kir2.2 ELISA Kit
MBS1602191-03 5x 96 Well

Bovine ATP-sensitive inward rectifier potassium channel 12, KCNJ12/Kir2.2 ELISA Kit

Sign In for Pricing
View Details
Bovine ATP-sensitive inward rectifier potassium channel 12, KCNJ12/Kir2.2 ELISA Kit
MBS1602191-04 10x 96 Well

Bovine ATP-sensitive inward rectifier potassium channel 12, KCNJ12/Kir2.2 ELISA Kit

Sign In for Pricing
View Details