Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transcriptional enhancer factor TEF-3 (Tead4), partial

This Recombinant Mouse Transcriptional enhancer factor TEF-3 (Tead4), partial spans the amino acid sequence from region 210-427aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ETF-related factor 2; ETFR-2; TEA domain family member 4; TEAD-4; TEF-1-related factor 1; TEF-1-related factor FR-19; RTEF-1

UniProt

Q62296

Expression Region

210-427aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSD3 Rabbit Polyclonal Antibody (Carrier-free)
orb3091761 100 µg

NSD3 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Mouse TWIST-Related Protein 1 (TWIST1) Protein
abx658648-01 10 µg

Mouse TWIST-Related Protein 1 (TWIST1) Protein

Sign In for Pricing
View Details
Mouse TWIST-Related Protein 1 (TWIST1) Protein
abx658648-02 50 µg

Mouse TWIST-Related Protein 1 (TWIST1) Protein

Sign In for Pricing
View Details
Mouse TWIST-Related Protein 1 (TWIST1) Protein
abx658648-03 100 µg

Mouse TWIST-Related Protein 1 (TWIST1) Protein

Sign In for Pricing
View Details
Mouse TWIST-Related Protein 1 (TWIST1) Protein
abx658648-04 200 µg

Mouse TWIST-Related Protein 1 (TWIST1) Protein

Sign In for Pricing
View Details
Mouse TWIST-Related Protein 1 (TWIST1) Protein
abx658648-05 500 µg

Mouse TWIST-Related Protein 1 (TWIST1) Protein

Sign In for Pricing
View Details