Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)
This Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES) spans the amino acid sequence from region 2-100aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
10 kDa antigen;10 kDa chaperonin; BCG-A heat shock protein; Chaperonin-10; Cpn10
UniProt
P9WPE5
Expression Region
2-100aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
37.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
031037-PE 200 µL
HSPA1A (HSPA1A, HSPA1, Heat shock 70kD protein 1A/1B, Heat shock 70kD protein 1/2) (PE) discontinued
Sign In for Pricing
View Details