Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein E6 (E6)

This Recombinant Mouse Protein E6 (E6) spans the amino acid sequence from region 1-140aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

D9D5K2

Expression Region

1-140aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus papillomavirus type 1

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEIGKGYTLEEVLRYSNKDVVDFHLSCAFCSTTMDHNEKARFIQAKLKCVVRDFAFKGACIVCRRQLACKEKLLHTRVTGEADLVECMAGKNIVFVTVRCVTCLALLTASEKLDAKACGLPFHLVRHMWRGYCGFCKPLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Ku80/XRCC5 Antibody (XRCC5/8093R) [PerCP]
NBP3-21133PCP 0.1 mL

Rabbit Monoclonal Ku80/XRCC5 Antibody (XRCC5/8093R) [PerCP]

Sign In for Pricing
View Details
Mouse Monoclonal Fc gamma RIIIA/CD16a Antibody (DJ130c) [DyLight 680]
NB100-64346FR 0.1 mL

Mouse Monoclonal Fc gamma RIIIA/CD16a Antibody (DJ130c) [DyLight 680]

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to FAK
sAP-0053 50 µg

Mouse Monoclonal Antibody to FAK

Sign In for Pricing
View Details
Human Big Dynorphin (Dyn) ELISA Kit
EK13741 48 Tests

Human Big Dynorphin (Dyn) ELISA Kit

Sign In for Pricing
View Details
Fish Emopamil-Binding Protein-Like (EBPL) ELISA Kit
MBS9924556 Inquire

Fish Emopamil-Binding Protein-Like (EBPL) ELISA Kit

Sign In for Pricing
View Details
BACE2-IT1 Protein Vector (Human) (pPM-N-D-C-His)
PV326097 500 ng

BACE2-IT1 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details